Edited by Alexis T. Bell, University of California, Berkeley, CA, and approved August 17, 2018 (received for review February 6, 2018) ...

Contributed by Ignacio Rodriguez-Iturbe; received October 2, 2021; accepted November 9, 2021; reviewed by Dennis Baldocchi and Gabriel Katul ...

Edited by Joshua Combes, University of Colorado, Boulder, CO; received September 9, 2023; accepted February 10, 2024, by Editorial Board Member Bernard F. Schutz ...

Contributed by J. Wade Harper; received September 23, 2024; accepted October 30, 2024; reviewed by Pietro V. De Camilli and Michael Lazarou This contribution is part of the special series of Inaugural ...

DsRed and its mutants were purified as described (5) by using the N-terminal polyhistidine tag MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDP provided by the pRSET B expression ...

Floyd E. Bloom, M.D. was a prominent leader and spokesperson for the neuroscience and broader scientific communities; sadly, Floyd passed away on January 8, 2025. His scientific contributions were ...

This work was supported by the National Key R&D Program of China (No. 2023YFD1400800) and the Zhejiang Key Research and Development Program of China (Nos. 2020C02001 ...

Contributed by Calyampudi Radhakrishna Rao, November 13, 2019 (sent for review October 14, 2019; reviewed by Ching-Kang Ing and Runze Li) ...

A mutation in salt-induced kinase 3 (hSIK3-N783Y) is identified in a human subject exhibiting the natural short sleep duration trait. A mouse model carrying this homologous mutation demonstrates ...

As AI tools become increasingly prevalent in workplaces, understanding the social dynamics of AI adoption is crucial. Through four experiments with over 4,400 participants, we reveal a social penalty ...

Heterotrimeric G proteins act as molecular switches that control cellular responses to external signals. Small molecules that selectively inhibit these proteins are essential for studying their ...

Two common findings from past research on sleep duration are that people who sleep too little suffer from various health consequences and that people from some cultures often have sleep durations that ...